Anti MLH1 pAb (ATL-HPA060714)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060714-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: MLH1
Alternative Gene Name: COCA2, FCC2, HNPCC, HNPCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032498: 94%, ENSRNOG00000033809: 93%
Entrez Gene ID: 4292
Uniprot ID: P40692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNV |
Gene Sequence | IATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNV |
Gene ID - Mouse | ENSMUSG00000032498 |
Gene ID - Rat | ENSRNOG00000033809 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MLH1 pAb (ATL-HPA060714) | |
Datasheet | Anti MLH1 pAb (ATL-HPA060714) Datasheet (External Link) |
Vendor Page | Anti MLH1 pAb (ATL-HPA060714) at Atlas Antibodies |
Documents & Links for Anti MLH1 pAb (ATL-HPA060714) | |
Datasheet | Anti MLH1 pAb (ATL-HPA060714) Datasheet (External Link) |
Vendor Page | Anti MLH1 pAb (ATL-HPA060714) |