Anti MLH1 pAb (ATL-HPA052707)

Atlas Antibodies

Catalog No.:
ATL-HPA052707-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: mutL homolog 1
Gene Name: MLH1
Alternative Gene Name: COCA2, FCC2, HNPCC, HNPCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032498: 83%, ENSRNOG00000033809: 83%
Entrez Gene ID: 4292
Uniprot ID: P40692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSE
Gene Sequence TKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSE
Gene ID - Mouse ENSMUSG00000032498
Gene ID - Rat ENSRNOG00000033809
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MLH1 pAb (ATL-HPA052707)
Datasheet Anti MLH1 pAb (ATL-HPA052707) Datasheet (External Link)
Vendor Page Anti MLH1 pAb (ATL-HPA052707) at Atlas Antibodies

Documents & Links for Anti MLH1 pAb (ATL-HPA052707)
Datasheet Anti MLH1 pAb (ATL-HPA052707) Datasheet (External Link)
Vendor Page Anti MLH1 pAb (ATL-HPA052707)