Anti MLH1 pAb (ATL-HPA052707)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052707-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: MLH1
Alternative Gene Name: COCA2, FCC2, HNPCC, HNPCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032498: 83%, ENSRNOG00000033809: 83%
Entrez Gene ID: 4292
Uniprot ID: P40692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSE |
| Gene Sequence | TKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSE |
| Gene ID - Mouse | ENSMUSG00000032498 |
| Gene ID - Rat | ENSRNOG00000033809 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MLH1 pAb (ATL-HPA052707) | |
| Datasheet | Anti MLH1 pAb (ATL-HPA052707) Datasheet (External Link) |
| Vendor Page | Anti MLH1 pAb (ATL-HPA052707) at Atlas Antibodies |
| Documents & Links for Anti MLH1 pAb (ATL-HPA052707) | |
| Datasheet | Anti MLH1 pAb (ATL-HPA052707) Datasheet (External Link) |
| Vendor Page | Anti MLH1 pAb (ATL-HPA052707) |