Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA067533-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-MLC1 antibody. Corresponding MLC1 RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and MLC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408351).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: megalencephalic leukoencephalopathy with subcortical cysts 1
Gene Name: MLC1
Alternative Gene Name: KIAA0027, LVM, MLC, VL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035805: 85%, ENSRNOG00000032871: 85%
Entrez Gene ID: 23209
Uniprot ID: Q15049
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQI
Gene Sequence NVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQI
Gene ID - Mouse ENSMUSG00000035805
Gene ID - Rat ENSRNOG00000032871
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation)
Datasheet Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation)
Datasheet Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation)