Anti MLANA pAb (ATL-HPA048662 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA048662-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: melan-A
Gene Name: MLANA
Alternative Gene Name: MART1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024806: 64%, ENSRNOG00000036608: 67%
Entrez Gene ID: 2315
Uniprot ID: Q16655
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Gene Sequence RRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Gene ID - Mouse ENSMUSG00000024806
Gene ID - Rat ENSRNOG00000036608
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MLANA pAb (ATL-HPA048662 w/enhanced validation)
Datasheet Anti MLANA pAb (ATL-HPA048662 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MLANA pAb (ATL-HPA048662 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MLANA pAb (ATL-HPA048662 w/enhanced validation)
Datasheet Anti MLANA pAb (ATL-HPA048662 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MLANA pAb (ATL-HPA048662 w/enhanced validation)
Citations for Anti MLANA pAb (ATL-HPA048662 w/enhanced validation) – 2 Found
Wang, Y; Zhang, G; Jin, J; Degan, S; Tameze, Y; Zhang, J Y. MALT1 promotes melanoma progression through JNK/c-Jun signaling. Oncogenesis. 2017;6(7):e365.  PubMed
Vendramin, Roberto; Katopodi, Vicky; Cinque, Sonia; Konnova, Angelina; Knezevic, Zorica; Adnane, Sara; Verheyden, Yvessa; Karras, Panagiotis; Demesmaeker, Ewout; Bosisio, Francesca M; Kucera, Lukas; Rozman, Jan; Gladwyn-Ng, Ivan; Rizzotto, Lara; Dassi, Erik; Millevoi, Stefania; Bechter, Oliver; Marine, Jean-Christophe; Leucci, Eleonora. Activation of the integrated stress response confers vulnerability to mitoribosome-targeting antibiotics in melanoma. The Journal Of Experimental Medicine. 2021;218(9)  PubMed