Anti MLANA pAb (ATL-HPA048662 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048662-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MLANA
Alternative Gene Name: MART1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024806: 64%, ENSRNOG00000036608: 67%
Entrez Gene ID: 2315
Uniprot ID: Q16655
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
| Gene Sequence | RRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
| Gene ID - Mouse | ENSMUSG00000024806 |
| Gene ID - Rat | ENSRNOG00000036608 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MLANA pAb (ATL-HPA048662 w/enhanced validation) | |
| Datasheet | Anti MLANA pAb (ATL-HPA048662 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MLANA pAb (ATL-HPA048662 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MLANA pAb (ATL-HPA048662 w/enhanced validation) | |
| Datasheet | Anti MLANA pAb (ATL-HPA048662 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MLANA pAb (ATL-HPA048662 w/enhanced validation) |
| Citations for Anti MLANA pAb (ATL-HPA048662 w/enhanced validation) – 2 Found |
| Wang, Y; Zhang, G; Jin, J; Degan, S; Tameze, Y; Zhang, J Y. MALT1 promotes melanoma progression through JNK/c-Jun signaling. Oncogenesis. 2017;6(7):e365. PubMed |
| Vendramin, Roberto; Katopodi, Vicky; Cinque, Sonia; Konnova, Angelina; Knezevic, Zorica; Adnane, Sara; Verheyden, Yvessa; Karras, Panagiotis; Demesmaeker, Ewout; Bosisio, Francesca M; Kucera, Lukas; Rozman, Jan; Gladwyn-Ng, Ivan; Rizzotto, Lara; Dassi, Erik; Millevoi, Stefania; Bechter, Oliver; Marine, Jean-Christophe; Leucci, Eleonora. Activation of the integrated stress response confers vulnerability to mitoribosome-targeting antibiotics in melanoma. The Journal Of Experimental Medicine. 2021;218(9) PubMed |