Anti MKRN2OS pAb (ATL-HPA065753)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065753-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MKRN2OS
Alternative Gene Name: C3orf83, MKRN2-AS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068011: 75%, ENSRNOG00000052003: 73%
Entrez Gene ID: 100129480
Uniprot ID: H3BPM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YDGRSDLHVGITNTNGVVYNYSAHGVQRDGEGWEESISIPLLQPNMYGMMEQWDKYLEDFSTSGAWLPHRYEDNH |
| Gene Sequence | YDGRSDLHVGITNTNGVVYNYSAHGVQRDGEGWEESISIPLLQPNMYGMMEQWDKYLEDFSTSGAWLPHRYEDNH |
| Gene ID - Mouse | ENSMUSG00000068011 |
| Gene ID - Rat | ENSRNOG00000052003 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MKRN2OS pAb (ATL-HPA065753) | |
| Datasheet | Anti MKRN2OS pAb (ATL-HPA065753) Datasheet (External Link) |
| Vendor Page | Anti MKRN2OS pAb (ATL-HPA065753) at Atlas Antibodies |
| Documents & Links for Anti MKRN2OS pAb (ATL-HPA065753) | |
| Datasheet | Anti MKRN2OS pAb (ATL-HPA065753) Datasheet (External Link) |
| Vendor Page | Anti MKRN2OS pAb (ATL-HPA065753) |