Anti MKRN2OS pAb (ATL-HPA065753)

Atlas Antibodies

Catalog No.:
ATL-HPA065753-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MKRN2 opposite strand
Gene Name: MKRN2OS
Alternative Gene Name: C3orf83, MKRN2-AS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068011: 75%, ENSRNOG00000052003: 73%
Entrez Gene ID: 100129480
Uniprot ID: H3BPM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YDGRSDLHVGITNTNGVVYNYSAHGVQRDGEGWEESISIPLLQPNMYGMMEQWDKYLEDFSTSGAWLPHRYEDNH
Gene Sequence YDGRSDLHVGITNTNGVVYNYSAHGVQRDGEGWEESISIPLLQPNMYGMMEQWDKYLEDFSTSGAWLPHRYEDNH
Gene ID - Mouse ENSMUSG00000068011
Gene ID - Rat ENSRNOG00000052003
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MKRN2OS pAb (ATL-HPA065753)
Datasheet Anti MKRN2OS pAb (ATL-HPA065753) Datasheet (External Link)
Vendor Page Anti MKRN2OS pAb (ATL-HPA065753) at Atlas Antibodies

Documents & Links for Anti MKRN2OS pAb (ATL-HPA065753)
Datasheet Anti MKRN2OS pAb (ATL-HPA065753) Datasheet (External Link)
Vendor Page Anti MKRN2OS pAb (ATL-HPA065753)