Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037559-25
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/89585/163326/atl-hpa037559_anti-mkrn2-pab-atl-hpa037559-wenhanced-validation_44966__12764.1681115519.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MKRN2
Alternative Gene Name: HSPC070, RNF62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000439: 81%, ENSRNOG00000009176: 79%
Entrez Gene ID: 23609
Uniprot ID: Q9H000
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQ |
| Gene Sequence | NSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQ |
| Gene ID - Mouse | ENSMUSG00000000439 |
| Gene ID - Rat | ENSRNOG00000009176 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) | |
| Datasheet | Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) | |
| Datasheet | Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) |
| Citations for Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) – 1 Found |
| Jiang, Jun; Xu, Yitong; Ren, Hongjiu; Wudu, Muli; Wang, Qiongzi; Song, Xin; Su, Hongbo; Jiang, Xizi; Jiang, Lihong; Qiu, Xueshan. MKRN2 inhibits migration and invasion of non-small-cell lung cancer by negatively regulating the PI3K/Akt pathway. Journal Of Experimental & Clinical Cancer Research : Cr. 2018;37(1):189. PubMed |