Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037559-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MKRN2
Alternative Gene Name: HSPC070, RNF62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000439: 81%, ENSRNOG00000009176: 79%
Entrez Gene ID: 23609
Uniprot ID: Q9H000
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQ |
| Gene Sequence | NSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQ |
| Gene ID - Mouse | ENSMUSG00000000439 |
| Gene ID - Rat | ENSRNOG00000009176 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) | |
| Datasheet | Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) | |
| Datasheet | Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) |
| Citations for Anti MKRN2 pAb (ATL-HPA037559 w/enhanced validation) – 1 Found |
| Jiang, Jun; Xu, Yitong; Ren, Hongjiu; Wudu, Muli; Wang, Qiongzi; Song, Xin; Su, Hongbo; Jiang, Xizi; Jiang, Lihong; Qiu, Xueshan. MKRN2 inhibits migration and invasion of non-small-cell lung cancer by negatively regulating the PI3K/Akt pathway. Journal Of Experimental & Clinical Cancer Research : Cr. 2018;37(1):189. PubMed |