Anti MKNK1 pAb (ATL-HPA071293)

Atlas Antibodies

Catalog No.:
ATL-HPA071293-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: MAP kinase interacting serine/threonine kinase 1
Gene Name: MKNK1
Alternative Gene Name: MNK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028708: 75%, ENSRNOG00000010381: 73%
Entrez Gene ID: 8569
Uniprot ID: Q9BUB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWS
Gene Sequence EKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWS
Gene ID - Mouse ENSMUSG00000028708
Gene ID - Rat ENSRNOG00000010381
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MKNK1 pAb (ATL-HPA071293)
Datasheet Anti MKNK1 pAb (ATL-HPA071293) Datasheet (External Link)
Vendor Page Anti MKNK1 pAb (ATL-HPA071293) at Atlas Antibodies

Documents & Links for Anti MKNK1 pAb (ATL-HPA071293)
Datasheet Anti MKNK1 pAb (ATL-HPA071293) Datasheet (External Link)
Vendor Page Anti MKNK1 pAb (ATL-HPA071293)