Anti MKNK1 pAb (ATL-HPA071293)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071293-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MKNK1
Alternative Gene Name: MNK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028708: 75%, ENSRNOG00000010381: 73%
Entrez Gene ID: 8569
Uniprot ID: Q9BUB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWS |
Gene Sequence | EKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWS |
Gene ID - Mouse | ENSMUSG00000028708 |
Gene ID - Rat | ENSRNOG00000010381 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MKNK1 pAb (ATL-HPA071293) | |
Datasheet | Anti MKNK1 pAb (ATL-HPA071293) Datasheet (External Link) |
Vendor Page | Anti MKNK1 pAb (ATL-HPA071293) at Atlas Antibodies |
Documents & Links for Anti MKNK1 pAb (ATL-HPA071293) | |
Datasheet | Anti MKNK1 pAb (ATL-HPA071293) Datasheet (External Link) |
Vendor Page | Anti MKNK1 pAb (ATL-HPA071293) |