Anti MKNK1 pAb (ATL-HPA071293)

Atlas Antibodies

Catalog No.: ATL-HPA071293-25

Protein Description: MAP kinase interacting serine/threonine kinase 1
Gene Name: MKNK1
Alternative Gene Name: MNK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028708: 75%, ENSRNOG00000010381: 73%
Entrez Gene ID: 8569
Uniprot ID: Q9BUB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWS
• Gene Sequence: EKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWS
• Gene ID - Mouse: ENSMUSG00000028708
• Gene ID - Rat: ENSRNOG00000010381
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.