Anti MKL1 pAb (ATL-HPA030782 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030782-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MKL1
Alternative Gene Name: BSAC, KIAA1438, MAL, MRTF-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042292: 65%, ENSRNOG00000018803: 66%
Entrez Gene ID: 57591
Uniprot ID: Q969V6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG |
| Gene Sequence | EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG |
| Gene ID - Mouse | ENSMUSG00000042292 |
| Gene ID - Rat | ENSRNOG00000018803 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MKL1 pAb (ATL-HPA030782 w/enhanced validation) | |
| Datasheet | Anti MKL1 pAb (ATL-HPA030782 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MKL1 pAb (ATL-HPA030782 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MKL1 pAb (ATL-HPA030782 w/enhanced validation) | |
| Datasheet | Anti MKL1 pAb (ATL-HPA030782 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MKL1 pAb (ATL-HPA030782 w/enhanced validation) |
| Citations for Anti MKL1 pAb (ATL-HPA030782 w/enhanced validation) – 10 Found |
| Gjorevski, Nikolce; Piotrowski, Alexandra S; Varner, Victor D; Nelson, Celeste M. Dynamic tensile forces drive collective cell migration through three-dimensional extracellular matrices. Scientific Reports. 2015;5( 26165921):11458. PubMed |
| Petrini, Stefania; Borghi, Rossella; D'Oria, Valentina; Restaldi, Fabrizia; Moreno, Sandra; Novelli, Antonio; Bertini, Enrico; Compagnucci, Claudia. Aged induced pluripotent stem cell (iPSCs) as a new cellular model for studying premature aging. Aging. 2017;9(5):1453-1469. PubMed |
| Whitson, Ramon J; Lee, Alex; Urman, Nicole M; Mirza, Amar; Yao, Catherine Y; Brown, Alexander S; Li, Jiang R; Shankar, Gautam; Fry, Micah A; Atwood, Scott X; Lee, Eunice Y; Hollmig, S Tyler; Aasi, Sumaira Z; Sarin, Kavita Y; Scott, Matthew P; Epstein, Ervin H Jr; Tang, Jean Y; Oro, Anthony E. Noncanonical hedgehog pathway activation through SRF-MKL1 promotes drug resistance in basal cell carcinomas. Nature Medicine. 2018;24(3):271-281. PubMed |
| Yu, Leqian; Li, Junjun; Hong, Jiayin; Takashima, Yasuhiro; Fujimoto, Nanae; Nakajima, Minako; Yamamoto, Akihisa; Dong, Xiaofeng; Dang, Yujiao; Hou, Yu; Yang, Wei; Minami, Itsunari; Okita, Keisuke; Tanaka, Motomu; Luo, Chunxiong; Tang, Fuchou; Chen, Yong; Tang, Chao; Kotera, Hidetoshi; Liu, Li. Low Cell-Matrix Adhesion Reveals Two Subtypes of Human Pluripotent Stem Cells. Stem Cell Reports. 2018;11(1):142-156. PubMed |
| Sánchez-Danés, Adriana; Larsimont, Jean-Christophe; Liagre, Mélanie; Muñoz-Couselo, Eva; Lapouge, Gaëlle; Brisebarre, Audrey; Dubois, Christine; Suppa, Mariano; Sukumaran, Vijayakumar; Del Marmol, Véronique; Tabernero, Josep; Blanpain, Cédric. A slow-cycling LGR5 tumour population mediates basal cell carcinoma relapse after therapy. Nature. 2018;562(7727):434-438. PubMed |
| Muehlich, S; Hampl, V; Khalid, S; Singer, S; Frank, N; Breuhahn, K; Gudermann, T; Prywes, R. The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1. Oncogene. 2012;31(35):3913-23. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Record, Julien; Malinova, Dessislava; Zenner, Helen L; Plagnol, Vincent; Nowak, Karolin; Syed, Farhatullah; Bouma, Gerben; Curtis, James; Gilmour, Kimberly; Cale, Catherine; Hackett, Scott; Charras, Guillaume; Moulding, Dale; Nejentsev, Sergey; Thrasher, Adrian J; Burns, Siobhan O. Immunodeficiency and severe susceptibility to bacterial infection associated with a loss-of-function homozygous mutation of MKL1. Blood. 2015;126(13):1527-35. PubMed |
| Aragona, Mariaceleste; Sifrim, Alejandro; Malfait, Milan; Song, Yura; Van Herck, Jens; Dekoninck, Sophie; Gargouri, Souhir; Lapouge, Gaëlle; Swedlund, Benjamin; Dubois, Christine; Baatsen, Pieter; Vints, Katlijn; Han, Seungmin; Tissir, Fadel; Voet, Thierry; Simons, Benjamin D; Blanpain, Cédric. Mechanisms of stretch-mediated skin expansion at single-cell resolution. Nature. 2020;584(7820):268-273. PubMed |
| Hu, Qiande; Zhu, Liang; Li, Yuan; Zhou, Jianjun; Xu, Jun. ACTA1 is inhibited by PAX3-FOXO1 through RhoA-MKL1-SRF signaling pathway and impairs cell proliferation, migration and tumor growth in Alveolar Rhabdomyosarcoma. Cell & Bioscience. 2021;11(1):25. PubMed |