Anti MKI67 pAb (ATL-HPA001164 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA001164-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: marker of proliferation Ki-67
Gene Name: MKI67
Alternative Gene Name: MIB-, PPP1R105
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031004: 68%, ENSRNOG00000028137: 68%
Entrez Gene ID: 4288
Uniprot ID: P46013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQSGRKSTEFPRKIREQEPARRVSRSSFSSDPDEKAQDSKAYSKITEGKVSGNPQVHI
Gene Sequence DGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQSGRKSTEFPRKIREQEPARRVSRSSFSSDPDEKAQDSKAYSKITEGKVSGNPQVHI
Gene ID - Mouse ENSMUSG00000031004
Gene ID - Rat ENSRNOG00000028137
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MKI67 pAb (ATL-HPA001164 w/enhanced validation)
Datasheet Anti MKI67 pAb (ATL-HPA001164 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MKI67 pAb (ATL-HPA001164 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MKI67 pAb (ATL-HPA001164 w/enhanced validation)
Datasheet Anti MKI67 pAb (ATL-HPA001164 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MKI67 pAb (ATL-HPA001164 w/enhanced validation)
Citations for Anti MKI67 pAb (ATL-HPA001164 w/enhanced validation) – 8 Found
Dusart, Philip; Fagerberg, Linn; Perisic, Ljubica; Civelek, Mete; Struck, Eike; Hedin, Ulf; Uhlén, Mathias; Trégouët, David-Alexandre; Renné, Thomas; Odeberg, Jacob; Butler, Lynn M. A systems-approach reveals human nestin is an endothelial-enriched, angiogenesis-independent intermediate filament protein. Scientific Reports. 2018;8(1):14668.  PubMed
Secomandi, Eleonora; Salwa, Amreen; Vidoni, Chiara; Ferraresi, Alessandra; Follo, Carlo; Isidoro, Ciro. High Expression of the Lysosomal Protease Cathepsin D Confers Better Prognosis in Neuroblastoma Patients by Contrasting EGF-Induced Neuroblastoma Cell Growth. International Journal Of Molecular Sciences. 2022;23(9)  PubMed
Esposito, Andrea; Ferraresi, Alessandra; Salwa, Amreen; Vidoni, Chiara; Dhanasekaran, Danny N; Isidoro, Ciro. Resveratrol Contrasts IL-6 Pro-Growth Effects and Promotes Autophagy-Mediated Cancer Cell Dormancy in 3D Ovarian Cancer: Role of miR-1305 and of Its Target ARH-I. Cancers. 2022;14(9)  PubMed
Garavaglia, Beatrice; Vallino, Letizia; Ferraresi, Alessandra; Esposito, Andrea; Salwa, Amreen; Vidoni, Chiara; Gentilli, Sergio; Isidoro, Ciro. Butyrate Inhibits Colorectal Cancer Cell Proliferation through Autophagy Degradation of β-Catenin Regardless of APC and β-Catenin Mutational Status. Biomedicines. 2022;10(5)  PubMed
Roca, Hernan; Craig, Matthew J; Ying, Chi; Varsos, Zachary S; Czarnieski, Paul; Alva, Ajjai S; Hernandez, James; Fuller, David; Daignault, Stephanie; Healy, Patrick N; Pienta, Kenneth J. IL-4 induces proliferation in prostate cancer PC3 cells under nutrient-depletion stress through the activation of the JNK-pathway and survivin up-regulation. Journal Of Cellular Biochemistry. 2012;113(5):1569-80.  PubMed
Geread, Rokshana Stephny; Sivanandarajah, Abishika; Brouwer, Emily Rita; Wood, Geoffrey A; Androutsos, Dimitrios; Faragalla, Hala; Khademi, April. piNET-An Automated Proliferation Index Calculator Framework for Ki67 Breast Cancer Images. Cancers. 2020;13(1)  PubMed
van Schaik, Tom; Manzo, Stefano G; Vouzas, Athanasios E; Liu, Ning Qing; Teunissen, Hans; de Wit, Elzo; Gilbert, David M; van Steensel, Bas. Dynamic chromosomal interactions and control of heterochromatin positioning by Ki-67. Embo Reports. 2022;23(12):e55782.  PubMed
Mangosh, Tawna L; Awadallah, Wisam N; Grabowska, Magdalena M; Taylor, Derek J. SLX4IP Promotes Telomere Maintenance in Androgen Receptor-Independent Castration-Resistant Prostate Cancer through ALT-like Telomeric PML Localization. Molecular Cancer Research : Mcr. 2021;19(2):301-316.  PubMed