Anti MKI67 pAb (ATL-HPA000451 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA000451-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: marker of proliferation Ki-67
Gene Name: MKI67
Alternative Gene Name: MIB-, PPP1R105
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031004: 66%, ENSRNOG00000028137: 67%
Entrez Gene ID: 4288
Uniprot ID: P46013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PAKVEDAADSATKPENLSSKTRGSIPTDVEVLPTETEIHNEPFLTLWLTQVERKIQKDSLSKPEKLGTTAGQMCSGLPGLSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFDENLPPNTPLKRGEAPTKRKSLVMHTPPVLKKIIK
Gene Sequence PAKVEDAADSATKPENLSSKTRGSIPTDVEVLPTETEIHNEPFLTLWLTQVERKIQKDSLSKPEKLGTTAGQMCSGLPGLSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFDENLPPNTPLKRGEAPTKRKSLVMHTPPVLKKIIK
Gene ID - Mouse ENSMUSG00000031004
Gene ID - Rat ENSRNOG00000028137
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MKI67 pAb (ATL-HPA000451 w/enhanced validation)
Datasheet Anti MKI67 pAb (ATL-HPA000451 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MKI67 pAb (ATL-HPA000451 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MKI67 pAb (ATL-HPA000451 w/enhanced validation)
Datasheet Anti MKI67 pAb (ATL-HPA000451 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MKI67 pAb (ATL-HPA000451 w/enhanced validation)
Citations for Anti MKI67 pAb (ATL-HPA000451 w/enhanced validation) – 5 Found
Pohler, Elizabeth; Mamai, Ons; Hirst, Jennifer; Zamiri, Mozheh; Horn, Helen; Nomura, Toshifumi; Irvine, Alan D; Moran, Benvon; Wilson, Neil J; Smith, Frances J D; Goh, Christabelle S M; Sandilands, Aileen; Cole, Christian; Barton, Geoffrey J; Evans, Alan T; Shimizu, Hiroshi; Akiyama, Masashi; Suehiro, Mitsuhiro; Konohana, Izumi; Shboul, Mohammad; Teissier, Sebastien; Boussofara, Lobna; Denguezli, Mohamed; Saad, Ali; Gribaa, Moez; Dopping-Hepenstal, Patricia J; McGrath, John A; Brown, Sara J; Goudie, David R; Reversade, Bruno; Munro, Colin S; McLean, W H Irwin. Haploinsufficiency for AAGAB causes clinically heterogeneous forms of punctate palmoplantar keratoderma. Nature Genetics. 2012;44(11):1272-6.  PubMed
Li, Suyan; Haigh, Katharina; Haigh, Jody J; Vasudevan, Anju. Endothelial VEGF sculpts cortical cytoarchitecture. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2013;33(37):14809-15.  PubMed
Guan, Siao-Syun; Cheng, Chun-Chia; Ho, Ai-Sheng; Wang, Chia-Chi; Luo, Tsai-Yueh; Liao, Tse-Zung; Chang, Jungshan; Wu, Cheng-Tien; Liu, Shing-Hwa. Sulfonamide derivative targeting carbonic anhydrase IX as a nuclear imaging probe for colorectal cancer detection in vivo. Oncotarget. 2015;6(34):36139-55.  PubMed
Cole, Alexander J; Iyengar, Mangala; Panesso-Gómez, Santiago; O'Hayer, Patrick; Chan, Daniel; Delgoffe, Greg M; Aird, Katherine M; Yoon, Euisik; Bai, Shoumei; Buckanovich, Ronald J. NFATC4 promotes quiescence and chemotherapy resistance in ovarian cancer. Jci Insight. 2020;5(7)  PubMed
Geread, Rokshana Stephny; Sivanandarajah, Abishika; Brouwer, Emily Rita; Wood, Geoffrey A; Androutsos, Dimitrios; Faragalla, Hala; Khademi, April. piNET-An Automated Proliferation Index Calculator Framework for Ki67 Breast Cancer Images. Cancers. 2020;13(1)  PubMed