Anti MITD1 pAb (ATL-HPA036163)

Atlas Antibodies

Catalog No.: ATL-HPA036163-25

Protein Description: MIT, microtubule interacting and transport, domain containing 1
Gene Name: MITD1
Alternative Gene Name: LOC129531
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026088: 90%, ENSRNOG00000018467: 93%
Entrez Gene ID: 129531
Uniprot ID: Q8WV92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEMLIKRPCKVKTIHLLTSLDE
• Gene Sequence: HKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEMLIKRPCKVKTIHLLTSLDE
• Gene ID - Mouse: ENSMUSG00000026088
• Gene ID - Rat: ENSRNOG00000018467
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.