Anti MITD1 pAb (ATL-HPA036162)

Atlas Antibodies

Catalog No.: ATL-HPA036162-25

Protein Description: MIT, microtubule interacting and transport, domain containing 1
Gene Name: MITD1
Alternative Gene Name: LOC129531
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026088: 81%, ENSRNOG00000018467: 80%
Entrez Gene ID: 129531
Uniprot ID: Q8WV92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQ
• Gene Sequence: MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQ
• Gene ID - Mouse: ENSMUSG00000026088
• Gene ID - Rat: ENSRNOG00000018467
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MITD1 pAb (ATL-HPA036162) – 1 Found

Chen, Yuanbin; Xu, Ting; Xie, Fei; Wang, Liping; Liang, Zhijuan; Li, Dan; Liang, Ye; Zhao, Kaidong; Qi, Xiangjie; Yang, Xuecheng; Jiao, Wei. Evaluating the biological functions of the prognostic genes identified by the Pathology Atlas in bladder cancer. Oncology Reports. 2021;45(1):191-201.