Anti MIPEP pAb (ATL-HPA030676)

Atlas Antibodies

Catalog No.:
ATL-HPA030676-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial intermediate peptidase
Gene Name: MIPEP
Alternative Gene Name: MIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021993: 88%, ENSRNOG00000013876: 91%
Entrez Gene ID: 4285
Uniprot ID: Q99797
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRFSHLVGYGARYYSYLMSRAVASMVWKECFLQDPFNRAAGERYRREMLAHGGGREPMLMVEGMLQKCPSVDDFVSALVSDLDLDFETFLMDS
Gene Sequence LRFSHLVGYGARYYSYLMSRAVASMVWKECFLQDPFNRAAGERYRREMLAHGGGREPMLMVEGMLQKCPSVDDFVSALVSDLDLDFETFLMDS
Gene ID - Mouse ENSMUSG00000021993
Gene ID - Rat ENSRNOG00000013876
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MIPEP pAb (ATL-HPA030676)
Datasheet Anti MIPEP pAb (ATL-HPA030676) Datasheet (External Link)
Vendor Page Anti MIPEP pAb (ATL-HPA030676) at Atlas Antibodies

Documents & Links for Anti MIPEP pAb (ATL-HPA030676)
Datasheet Anti MIPEP pAb (ATL-HPA030676) Datasheet (External Link)
Vendor Page Anti MIPEP pAb (ATL-HPA030676)