Anti MINDY2 pAb (ATL-HPA063669)

Atlas Antibodies

Catalog No.:
ATL-HPA063669-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: MINDY lysine 48 deubiquitinase 2
Gene Name: MINDY2
Alternative Gene Name: FAM63B, KIAA1164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042444: 50%, ENSRNOG00000061337: 52%
Entrez Gene ID: 54629
Uniprot ID: Q8NBR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSSAGLDLKDSGLESPAAAEAPLRGQYKVTASPETAVAGVGHELGTAGDAGARPDLAGTCQAELTA
Gene Sequence SSSAGLDLKDSGLESPAAAEAPLRGQYKVTASPETAVAGVGHELGTAGDAGARPDLAGTCQAELTA
Gene ID - Mouse ENSMUSG00000042444
Gene ID - Rat ENSRNOG00000061337
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MINDY2 pAb (ATL-HPA063669)
Datasheet Anti MINDY2 pAb (ATL-HPA063669) Datasheet (External Link)
Vendor Page Anti MINDY2 pAb (ATL-HPA063669) at Atlas Antibodies

Documents & Links for Anti MINDY2 pAb (ATL-HPA063669)
Datasheet Anti MINDY2 pAb (ATL-HPA063669) Datasheet (External Link)
Vendor Page Anti MINDY2 pAb (ATL-HPA063669)