Anti MIER3 pAb (ATL-HPA058349)

Atlas Antibodies

Catalog No.:
ATL-HPA058349-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mesoderm induction early response 1, family member 3
Gene Name: MIER3
Alternative Gene Name: DKFZp686L09111, DKFZp781I1119, FLJ35954
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032727: 86%, ENSRNOG00000013121: 94%
Entrez Gene ID: 166968
Uniprot ID: Q7Z3K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HETSDFFPRPLRSNTACDGDKESEVEDVETDSGNSPEDLRKEIMIGLQYQAEIPPYLGEYDGNEK
Gene Sequence HETSDFFPRPLRSNTACDGDKESEVEDVETDSGNSPEDLRKEIMIGLQYQAEIPPYLGEYDGNEK
Gene ID - Mouse ENSMUSG00000032727
Gene ID - Rat ENSRNOG00000013121
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MIER3 pAb (ATL-HPA058349)
Datasheet Anti MIER3 pAb (ATL-HPA058349) Datasheet (External Link)
Vendor Page Anti MIER3 pAb (ATL-HPA058349) at Atlas Antibodies

Documents & Links for Anti MIER3 pAb (ATL-HPA058349)
Datasheet Anti MIER3 pAb (ATL-HPA058349) Datasheet (External Link)
Vendor Page Anti MIER3 pAb (ATL-HPA058349)