Anti MIER3 pAb (ATL-HPA058349)

Atlas Antibodies

Catalog No.: ATL-HPA058349-25

Protein Description: mesoderm induction early response 1, family member 3
Gene Name: MIER3
Alternative Gene Name: DKFZp686L09111, DKFZp781I1119, FLJ35954
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032727: 86%, ENSRNOG00000013121: 94%
Entrez Gene ID: 166968
Uniprot ID: Q7Z3K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HETSDFFPRPLRSNTACDGDKESEVEDVETDSGNSPEDLRKEIMIGLQYQAEIPPYLGEYDGNEK
• Gene Sequence: HETSDFFPRPLRSNTACDGDKESEVEDVETDSGNSPEDLRKEIMIGLQYQAEIPPYLGEYDGNEK
• Gene ID - Mouse: ENSMUSG00000032727
• Gene ID - Rat: ENSRNOG00000013121
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.