Anti MIEN1 pAb (ATL-HPA061344)

Atlas Antibodies

Catalog No.:
ATL-HPA061344-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: migration and invasion enhancer 1
Gene Name: MIEN1
Alternative Gene Name: C17orf37, C35, MGC14832, ORB3, Rdx12, XTP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002580: 94%, ENSRNOG00000007227: 96%
Entrez Gene ID: 84299
Uniprot ID: Q9BRT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRP
Gene Sequence GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRP
Gene ID - Mouse ENSMUSG00000002580
Gene ID - Rat ENSRNOG00000007227
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MIEN1 pAb (ATL-HPA061344)
Datasheet Anti MIEN1 pAb (ATL-HPA061344) Datasheet (External Link)
Vendor Page Anti MIEN1 pAb (ATL-HPA061344) at Atlas Antibodies

Documents & Links for Anti MIEN1 pAb (ATL-HPA061344)
Datasheet Anti MIEN1 pAb (ATL-HPA061344) Datasheet (External Link)
Vendor Page Anti MIEN1 pAb (ATL-HPA061344)