Anti MIDN pAb (ATL-HPA049432)

Atlas Antibodies

Catalog No.:
ATL-HPA049432-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: midnolin
Gene Name: MIDN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035621: 92%, ENSRNOG00000015434: 88%
Entrez Gene ID: 90007
Uniprot ID: Q504T8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTTSCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVER
Gene Sequence LNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTTSCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVER
Gene ID - Mouse ENSMUSG00000035621
Gene ID - Rat ENSRNOG00000015434
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MIDN pAb (ATL-HPA049432)
Datasheet Anti MIDN pAb (ATL-HPA049432) Datasheet (External Link)
Vendor Page Anti MIDN pAb (ATL-HPA049432) at Atlas Antibodies

Documents & Links for Anti MIDN pAb (ATL-HPA049432)
Datasheet Anti MIDN pAb (ATL-HPA049432) Datasheet (External Link)
Vendor Page Anti MIDN pAb (ATL-HPA049432)