Anti MIDN pAb (ATL-HPA049432)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049432-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MIDN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035621: 92%, ENSRNOG00000015434: 88%
Entrez Gene ID: 90007
Uniprot ID: Q504T8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTTSCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVER |
Gene Sequence | LNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTTSCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVER |
Gene ID - Mouse | ENSMUSG00000035621 |
Gene ID - Rat | ENSRNOG00000015434 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MIDN pAb (ATL-HPA049432) | |
Datasheet | Anti MIDN pAb (ATL-HPA049432) Datasheet (External Link) |
Vendor Page | Anti MIDN pAb (ATL-HPA049432) at Atlas Antibodies |
Documents & Links for Anti MIDN pAb (ATL-HPA049432) | |
Datasheet | Anti MIDN pAb (ATL-HPA049432) Datasheet (External Link) |
Vendor Page | Anti MIDN pAb (ATL-HPA049432) |