Anti MICB pAb (ATL-HPA064618)

Atlas Antibodies

SKU:
ATL-HPA064618-25
  • Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus & vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: MHC class I polypeptide-related sequence B
Gene Name: MICB
Alternative Gene Name: PERB11.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023030: 33%, ENSRNOG00000019550: 33%
Entrez Gene ID: 4277
Uniprot ID: Q29980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE
Gene Sequence CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE
Gene ID - Mouse ENSMUSG00000023030
Gene ID - Rat ENSRNOG00000019550
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MICB pAb (ATL-HPA064618)
Datasheet Anti MICB pAb (ATL-HPA064618) Datasheet (External Link)
Vendor Page Anti MICB pAb (ATL-HPA064618) at Atlas Antibodies

Documents & Links for Anti MICB pAb (ATL-HPA064618)
Datasheet Anti MICB pAb (ATL-HPA064618) Datasheet (External Link)
Vendor Page Anti MICB pAb (ATL-HPA064618)