Anti MICALL1 pAb (ATL-HPA051956)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051956-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MICALL1
Alternative Gene Name: KIAA1668, MICAL-L1, MIRAB13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033039: 86%, ENSRNOG00000026212: 88%
Entrez Gene ID: 85377
Uniprot ID: Q8N3F8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAK |
| Gene Sequence | QADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAK |
| Gene ID - Mouse | ENSMUSG00000033039 |
| Gene ID - Rat | ENSRNOG00000026212 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MICALL1 pAb (ATL-HPA051956) | |
| Datasheet | Anti MICALL1 pAb (ATL-HPA051956) Datasheet (External Link) |
| Vendor Page | Anti MICALL1 pAb (ATL-HPA051956) at Atlas Antibodies |
| Documents & Links for Anti MICALL1 pAb (ATL-HPA051956) | |
| Datasheet | Anti MICALL1 pAb (ATL-HPA051956) Datasheet (External Link) |
| Vendor Page | Anti MICALL1 pAb (ATL-HPA051956) |