Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA077929-25
  • Immunohistochemistry analysis in human heart muscle and tonsil tissues using Anti-MGST3 antibody. Corresponding MGST3 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: microsomal glutathione S-transferase 3
Gene Name: MGST3
Alternative Gene Name: GST-III
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026688: 90%, ENSRNOG00000004245: 90%
Entrez Gene ID: 4259
Uniprot ID: O14880
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INVSKARKKYKVEYPIMYSTDPENGHIFNC
Gene Sequence INVSKARKKYKVEYPIMYSTDPENGHIFNC
Gene ID - Mouse ENSMUSG00000026688
Gene ID - Rat ENSRNOG00000004245
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation)
Datasheet Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation)
Datasheet Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation)