Anti MGMT pAb (ATL-HPA069497)
Atlas Antibodies
- SKU:
- ATL-HPA069497-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: MGMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054612: 59%, ENSRNOG00000016038: 61%
Entrez Gene ID: 4255
Uniprot ID: P16455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPE |
Gene Sequence | KDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPE |
Gene ID - Mouse | ENSMUSG00000054612 |
Gene ID - Rat | ENSRNOG00000016038 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MGMT pAb (ATL-HPA069497) | |
Datasheet | Anti MGMT pAb (ATL-HPA069497) Datasheet (External Link) |
Vendor Page | Anti MGMT pAb (ATL-HPA069497) at Atlas Antibodies |
Documents & Links for Anti MGMT pAb (ATL-HPA069497) | |
Datasheet | Anti MGMT pAb (ATL-HPA069497) Datasheet (External Link) |
Vendor Page | Anti MGMT pAb (ATL-HPA069497) |
Citations for Anti MGMT pAb (ATL-HPA069497) – 1 Found |
Stoyanov, George S; Lyutfi, Emran; Georgieva, Reneta; Georgiev, Radoslav; Dzhenkov, Deyan L; Petkova, Lilyana; Ivanov, Borislav D; Kaprelyan, Ara; Ghenev, Peter. Reclassification of Glioblastoma Multiforme According to the 2021 World Health Organization Classification of Central Nervous System Tumors: A Single Institution Report and Practical Significance. Cureus. 2022;14(2):e21822. PubMed |