Anti MGMT pAb (ATL-HPA069497)

Atlas Antibodies

Catalog No.:
ATL-HPA069497-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: O-6-methylguanine-DNA methyltransferase
Gene Name: MGMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054612: 59%, ENSRNOG00000016038: 61%
Entrez Gene ID: 4255
Uniprot ID: P16455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPE
Gene Sequence KDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPE
Gene ID - Mouse ENSMUSG00000054612
Gene ID - Rat ENSRNOG00000016038
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MGMT pAb (ATL-HPA069497)
Datasheet Anti MGMT pAb (ATL-HPA069497) Datasheet (External Link)
Vendor Page Anti MGMT pAb (ATL-HPA069497) at Atlas Antibodies

Documents & Links for Anti MGMT pAb (ATL-HPA069497)
Datasheet Anti MGMT pAb (ATL-HPA069497) Datasheet (External Link)
Vendor Page Anti MGMT pAb (ATL-HPA069497)
Citations for Anti MGMT pAb (ATL-HPA069497) – 1 Found
Stoyanov, George S; Lyutfi, Emran; Georgieva, Reneta; Georgiev, Radoslav; Dzhenkov, Deyan L; Petkova, Lilyana; Ivanov, Borislav D; Kaprelyan, Ara; Ghenev, Peter. Reclassification of Glioblastoma Multiforme According to the 2021 World Health Organization Classification of Central Nervous System Tumors: A Single Institution Report and Practical Significance. Cureus. 2022;14(2):e21822.  PubMed