Anti MGAT2 pAb (ATL-HPA056824)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056824-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MGAT2
Alternative Gene Name: GNT-II
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043998: 99%, ENSRNOG00000004234: 97%
Entrez Gene ID: 4247
Uniprot ID: Q10469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWER |
Gene Sequence | QVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWER |
Gene ID - Mouse | ENSMUSG00000043998 |
Gene ID - Rat | ENSRNOG00000004234 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MGAT2 pAb (ATL-HPA056824) | |
Datasheet | Anti MGAT2 pAb (ATL-HPA056824) Datasheet (External Link) |
Vendor Page | Anti MGAT2 pAb (ATL-HPA056824) at Atlas Antibodies |
Documents & Links for Anti MGAT2 pAb (ATL-HPA056824) | |
Datasheet | Anti MGAT2 pAb (ATL-HPA056824) Datasheet (External Link) |
Vendor Page | Anti MGAT2 pAb (ATL-HPA056824) |