Anti MGA pAb (ATL-HPA058183)

Atlas Antibodies

Catalog No.:
ATL-HPA058183-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: MGA, MAX dimerization protein
Gene Name: MGA
Alternative Gene Name: FLJ12634, KIAA0518, MAD5, MXD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033943: 94%, ENSRNOG00000006378: 95%
Entrez Gene ID: 23269
Uniprot ID: Q8IWI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGVQLPLAPATSFPFWNLTGTNPASPDAGFPFVSRTGKTNDFTKIKGWRGKFHSASASRNEGGNSESSLKNRSAFCSD
Gene Sequence LGVQLPLAPATSFPFWNLTGTNPASPDAGFPFVSRTGKTNDFTKIKGWRGKFHSASASRNEGGNSESSLKNRSAFCSD
Gene ID - Mouse ENSMUSG00000033943
Gene ID - Rat ENSRNOG00000006378
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MGA pAb (ATL-HPA058183)
Datasheet Anti MGA pAb (ATL-HPA058183) Datasheet (External Link)
Vendor Page Anti MGA pAb (ATL-HPA058183) at Atlas Antibodies

Documents & Links for Anti MGA pAb (ATL-HPA058183)
Datasheet Anti MGA pAb (ATL-HPA058183) Datasheet (External Link)
Vendor Page Anti MGA pAb (ATL-HPA058183)