Anti MFSD9 pAb (ATL-HPA061859)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061859-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MFSD9
Alternative Gene Name: MGC11332
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041945: 41%, ENSRNOG00000023129: 38%
Entrez Gene ID: 84804
Uniprot ID: Q8NBP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGSTEKGLPLRKTHVLLGRSHDTVQEAATSRRARASKKTAQPWVEVVLALRNMKNLLF |
Gene Sequence | PGSTEKGLPLRKTHVLLGRSHDTVQEAATSRRARASKKTAQPWVEVVLALRNMKNLLF |
Gene ID - Mouse | ENSMUSG00000041945 |
Gene ID - Rat | ENSRNOG00000023129 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MFSD9 pAb (ATL-HPA061859) | |
Datasheet | Anti MFSD9 pAb (ATL-HPA061859) Datasheet (External Link) |
Vendor Page | Anti MFSD9 pAb (ATL-HPA061859) at Atlas Antibodies |
Documents & Links for Anti MFSD9 pAb (ATL-HPA061859) | |
Datasheet | Anti MFSD9 pAb (ATL-HPA061859) Datasheet (External Link) |
Vendor Page | Anti MFSD9 pAb (ATL-HPA061859) |