Anti MFSD8 pAb (ATL-HPA044802)

Atlas Antibodies

Catalog No.:
ATL-HPA044802-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: major facilitator superfamily domain containing 8
Gene Name: MFSD8
Alternative Gene Name: CLN7, MGC33302
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025759: 66%, ENSRNOG00000012729: 66%
Entrez Gene ID: 256471
Uniprot ID: Q8NHS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWR
Gene Sequence MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWR
Gene ID - Mouse ENSMUSG00000025759
Gene ID - Rat ENSRNOG00000012729
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MFSD8 pAb (ATL-HPA044802)
Datasheet Anti MFSD8 pAb (ATL-HPA044802) Datasheet (External Link)
Vendor Page Anti MFSD8 pAb (ATL-HPA044802) at Atlas Antibodies

Documents & Links for Anti MFSD8 pAb (ATL-HPA044802)
Datasheet Anti MFSD8 pAb (ATL-HPA044802) Datasheet (External Link)
Vendor Page Anti MFSD8 pAb (ATL-HPA044802)
Citations for Anti MFSD8 pAb (ATL-HPA044802) – 3 Found
Wang, Yayu; Zeng, Wenping; Lin, Bingqian; Yao, Yichuan; Li, Canjun; Hu, Wenqi; Wu, Haotian; Huang, Jiamin; Zhang, Mei; Xue, Tian; Ren, Dejian; Qu, Lili; Cang, Chunlei. CLN7 is an organellar chloride channel regulating lysosomal function. Science Advances. 2021;7(51):eabj9608.  PubMed
Perland, Emelie; Bagchi, Sonchita; Klaesson, Axel; Fredriksson, Robert. Characteristics of 29 novel atypical solute carriers of major facilitator superfamily type: evolutionary conservation, predicted structure and neuronal co-expression. Open Biology. 2017;7(9)  PubMed
Geier, Ethan G; Bourdenx, Mathieu; Storm, Nadia J; Cochran, J Nicholas; Sirkis, Daniel W; Hwang, Ji-Hye; Bonham, Luke W; Ramos, Eliana Marisa; Diaz, Antonio; Van Berlo, Victoria; Dokuru, Deepika; Nana, Alissa L; Karydas, Anna; Balestra, Maureen E; Huang, Yadong; Russo, Silvia P; Spina, Salvatore; Grinberg, Lea T; Seeley, William W; Myers, Richard M; Miller, Bruce L; Coppola, Giovanni; Lee, Suzee E; Cuervo, Ana Maria; Yokoyama, Jennifer S. Rare variants in the neuronal ceroid lipofuscinosis gene MFSD8 are candidate risk factors for frontotemporal dementia. Acta Neuropathologica. 2019;137(1):71-88.  PubMed