Anti MFSD8 pAb (ATL-HPA044802)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044802-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MFSD8
Alternative Gene Name: CLN7, MGC33302
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025759: 66%, ENSRNOG00000012729: 66%
Entrez Gene ID: 256471
Uniprot ID: Q8NHS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWR |
| Gene Sequence | MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWR |
| Gene ID - Mouse | ENSMUSG00000025759 |
| Gene ID - Rat | ENSRNOG00000012729 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MFSD8 pAb (ATL-HPA044802) | |
| Datasheet | Anti MFSD8 pAb (ATL-HPA044802) Datasheet (External Link) |
| Vendor Page | Anti MFSD8 pAb (ATL-HPA044802) at Atlas Antibodies |
| Documents & Links for Anti MFSD8 pAb (ATL-HPA044802) | |
| Datasheet | Anti MFSD8 pAb (ATL-HPA044802) Datasheet (External Link) |
| Vendor Page | Anti MFSD8 pAb (ATL-HPA044802) |
| Citations for Anti MFSD8 pAb (ATL-HPA044802) – 3 Found |
| Wang, Yayu; Zeng, Wenping; Lin, Bingqian; Yao, Yichuan; Li, Canjun; Hu, Wenqi; Wu, Haotian; Huang, Jiamin; Zhang, Mei; Xue, Tian; Ren, Dejian; Qu, Lili; Cang, Chunlei. CLN7 is an organellar chloride channel regulating lysosomal function. Science Advances. 2021;7(51):eabj9608. PubMed |
| Perland, Emelie; Bagchi, Sonchita; Klaesson, Axel; Fredriksson, Robert. Characteristics of 29 novel atypical solute carriers of major facilitator superfamily type: evolutionary conservation, predicted structure and neuronal co-expression. Open Biology. 2017;7(9) PubMed |
| Geier, Ethan G; Bourdenx, Mathieu; Storm, Nadia J; Cochran, J Nicholas; Sirkis, Daniel W; Hwang, Ji-Hye; Bonham, Luke W; Ramos, Eliana Marisa; Diaz, Antonio; Van Berlo, Victoria; Dokuru, Deepika; Nana, Alissa L; Karydas, Anna; Balestra, Maureen E; Huang, Yadong; Russo, Silvia P; Spina, Salvatore; Grinberg, Lea T; Seeley, William W; Myers, Richard M; Miller, Bruce L; Coppola, Giovanni; Lee, Suzee E; Cuervo, Ana Maria; Yokoyama, Jennifer S. Rare variants in the neuronal ceroid lipofuscinosis gene MFSD8 are candidate risk factors for frontotemporal dementia. Acta Neuropathologica. 2019;137(1):71-88. PubMed |