Anti MFSD5 pAb (ATL-HPA039773)

Atlas Antibodies

Catalog No.: ATL-HPA039773-25

Protein Description: major facilitator superfamily domain containing 5
Gene Name: MFSD5
Alternative Gene Name: MGC11308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045665: 97%, ENSRNOG00000012832: 97%
Entrez Gene ID: 84975
Uniprot ID: Q6N075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVIPETEQAGVLNWFRVPLHSLACLGLLVLHDSDR
• Gene Sequence: KVIPETEQAGVLNWFRVPLHSLACLGLLVLHDSDR
• Gene ID - Mouse: ENSMUSG00000045665
• Gene ID - Rat: ENSRNOG00000012832
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.