Anti MFHAS1 pAb (ATL-HPA051213)

Atlas Antibodies

Catalog No.: ATL-HPA051213-100

Protein Description: malignant fibrous histiocytoma amplified sequence 1
Gene Name: MFHAS1
Alternative Gene Name: LRRC65, MASL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070056: 100%, ENSRNOG00000011431: 90%
Entrez Gene ID: 9258
Uniprot ID: Q9Y4C4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGLHYTVHILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHR
• Gene Sequence: PGLHYTVHILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHR
• Gene ID - Mouse: ENSMUSG00000070056
• Gene ID - Rat: ENSRNOG00000011431
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.