Anti MFHAS1 pAb (ATL-HPA051213)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051213-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: MFHAS1
Alternative Gene Name: LRRC65, MASL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070056: 100%, ENSRNOG00000011431: 90%
Entrez Gene ID: 9258
Uniprot ID: Q9Y4C4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGLHYTVHILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHR |
Gene Sequence | PGLHYTVHILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHR |
Gene ID - Mouse | ENSMUSG00000070056 |
Gene ID - Rat | ENSRNOG00000011431 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MFHAS1 pAb (ATL-HPA051213) | |
Datasheet | Anti MFHAS1 pAb (ATL-HPA051213) Datasheet (External Link) |
Vendor Page | Anti MFHAS1 pAb (ATL-HPA051213) at Atlas Antibodies |
Documents & Links for Anti MFHAS1 pAb (ATL-HPA051213) | |
Datasheet | Anti MFHAS1 pAb (ATL-HPA051213) Datasheet (External Link) |
Vendor Page | Anti MFHAS1 pAb (ATL-HPA051213) |