Anti MFHAS1 pAb (ATL-HPA051213)

Atlas Antibodies

Catalog No.:
ATL-HPA051213-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: malignant fibrous histiocytoma amplified sequence 1
Gene Name: MFHAS1
Alternative Gene Name: LRRC65, MASL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070056: 100%, ENSRNOG00000011431: 90%
Entrez Gene ID: 9258
Uniprot ID: Q9Y4C4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGLHYTVHILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHR
Gene Sequence PGLHYTVHILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHR
Gene ID - Mouse ENSMUSG00000070056
Gene ID - Rat ENSRNOG00000011431
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MFHAS1 pAb (ATL-HPA051213)
Datasheet Anti MFHAS1 pAb (ATL-HPA051213) Datasheet (External Link)
Vendor Page Anti MFHAS1 pAb (ATL-HPA051213) at Atlas Antibodies

Documents & Links for Anti MFHAS1 pAb (ATL-HPA051213)
Datasheet Anti MFHAS1 pAb (ATL-HPA051213) Datasheet (External Link)
Vendor Page Anti MFHAS1 pAb (ATL-HPA051213)