Anti MFF pAb (ATL-HPA074625)

Atlas Antibodies

Catalog No.:
ATL-HPA074625-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mitochondrial fission factor
Gene Name: MFF
Alternative Gene Name: C2orf33, GL004
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026150: 93%, ENSRNOG00000015428: 96%
Entrez Gene ID: 56947
Uniprot ID: Q9GZY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLWH
Gene Sequence DLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLWH
Gene ID - Mouse ENSMUSG00000026150
Gene ID - Rat ENSRNOG00000015428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MFF pAb (ATL-HPA074625)
Datasheet Anti MFF pAb (ATL-HPA074625) Datasheet (External Link)
Vendor Page Anti MFF pAb (ATL-HPA074625) at Atlas Antibodies

Documents & Links for Anti MFF pAb (ATL-HPA074625)
Datasheet Anti MFF pAb (ATL-HPA074625) Datasheet (External Link)
Vendor Page Anti MFF pAb (ATL-HPA074625)