Anti MFAP5 pAb (ATL-HPA010553 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010553-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MFAP5
Alternative Gene Name: MAGP2, MP25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030116: 81%, ENSRNOG00000015505: 83%
Entrez Gene ID: 8076
Uniprot ID: Q13361
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENV |
| Gene Sequence | GVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENV |
| Gene ID - Mouse | ENSMUSG00000030116 |
| Gene ID - Rat | ENSRNOG00000015505 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MFAP5 pAb (ATL-HPA010553 w/enhanced validation) | |
| Datasheet | Anti MFAP5 pAb (ATL-HPA010553 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MFAP5 pAb (ATL-HPA010553 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MFAP5 pAb (ATL-HPA010553 w/enhanced validation) | |
| Datasheet | Anti MFAP5 pAb (ATL-HPA010553 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MFAP5 pAb (ATL-HPA010553 w/enhanced validation) |
| Citations for Anti MFAP5 pAb (ATL-HPA010553 w/enhanced validation) – 5 Found |
| Yang, Xi; Wu, Kailiu; Li, Siyi; Hu, Longwei; Han, Jing; Zhu, Dongwang; Tian, Xuerui; Liu, Wei; Tian, Zhen; Zhong, Laiping; Yan, Ming; Zhang, Chenping; Zhang, Zhiyuan. MFAP5 and TNNC1: Potential markers for predicting occult cervical lymphatic metastasis and prognosis in early stage tongue cancer. Oncotarget. 2017;8(2):2525-2535. PubMed |
| Leung, Cecilia S; Yeung, Tsz-Lun; Yip, Kay-Pong; Pradeep, Sunila; Balasubramanian, Lavanya; Liu, Jinsong; Wong, Kwong-Kwok; Mangala, Lingegowda S; Armaiz-Pena, Guillermo N; Lopez-Berestein, Gabriel; Sood, Anil K; Birrer, Michael J; Mok, Samuel C. Calcium-dependent FAK/CREB/TNNC1 signalling mediates the effect of stromal MFAP5 on ovarian cancer metastatic potential. Nature Communications. 2014;5( 25277212):5092. PubMed |
| Philippeos, Christina; Telerman, Stephanie B; Oulès, Bénédicte; Pisco, Angela O; Shaw, Tanya J; Elgueta, Raul; Lombardi, Giovanna; Driskell, Ryan R; Soldin, Mark; Lynch, Magnus D; Watt, Fiona M. Spatial and Single-Cell Transcriptional Profiling Identifies Functionally Distinct Human Dermal Fibroblast Subpopulations. The Journal Of Investigative Dermatology. 2018;138(4):811-825. PubMed |
| Xu, Qiaoshi; Chang, Hanyue; Tian, Xuerui; Lou, Chao; Ma, Hailong; Yang, Xi. Hypoxia-induced MFAP5 Promotes Tumor Migration and Invasion via AKT Pathway in Head and Neck Squamous Cell Carcinoma. Journal Of Cancer. 11(6):1596-1605. PubMed |
| Kujawa, Katarzyna Aleksandra; Zembala-Nożynska, Ewa; Syrkis, Joanna Patrycja; Cortez, Alexander Jorge; Kupryjańczyk, Jolanta; Lisowska, Katarzyna Marta. Microfibril Associated Protein 5 (MFAP5) Is Related to Survival of Ovarian Cancer Patients but Not Useful as a Prognostic Biomarker. International Journal Of Molecular Sciences. 2022;23(24) PubMed |