Anti MFAP3 pAb (ATL-HPA015883)

Atlas Antibodies

Catalog No.:
ATL-HPA015883-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: microfibrillar-associated protein 3
Gene Name: MFAP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020522: 85%, ENSRNOG00000002443: 85%
Entrez Gene ID: 4238
Uniprot ID: P55082
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGA
Gene Sequence EFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGA
Gene ID - Mouse ENSMUSG00000020522
Gene ID - Rat ENSRNOG00000002443
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MFAP3 pAb (ATL-HPA015883)
Datasheet Anti MFAP3 pAb (ATL-HPA015883) Datasheet (External Link)
Vendor Page Anti MFAP3 pAb (ATL-HPA015883) at Atlas Antibodies

Documents & Links for Anti MFAP3 pAb (ATL-HPA015883)
Datasheet Anti MFAP3 pAb (ATL-HPA015883) Datasheet (External Link)
Vendor Page Anti MFAP3 pAb (ATL-HPA015883)