Anti MFAP3 pAb (ATL-HPA015883)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015883-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: MFAP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020522: 85%, ENSRNOG00000002443: 85%
Entrez Gene ID: 4238
Uniprot ID: P55082
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGA |
| Gene Sequence | EFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGA |
| Gene ID - Mouse | ENSMUSG00000020522 |
| Gene ID - Rat | ENSRNOG00000002443 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MFAP3 pAb (ATL-HPA015883) | |
| Datasheet | Anti MFAP3 pAb (ATL-HPA015883) Datasheet (External Link) |
| Vendor Page | Anti MFAP3 pAb (ATL-HPA015883) at Atlas Antibodies |
| Documents & Links for Anti MFAP3 pAb (ATL-HPA015883) | |
| Datasheet | Anti MFAP3 pAb (ATL-HPA015883) Datasheet (External Link) |
| Vendor Page | Anti MFAP3 pAb (ATL-HPA015883) |