Anti MFAP1 pAb (ATL-HPA015583)

Atlas Antibodies

Catalog No.: ATL-HPA015583-100

Protein Description: microfibril associated protein 1
Gene Name: MFAP1
Alternative Gene Name: AMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068479: 99%, ENSRNOG00000014436: 100%
Entrez Gene ID: 4236
Uniprot ID: P55081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVMQVKNFGRSG
• Gene Sequence: KELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVMQVKNFGRSG
• Gene ID - Mouse: ENSMUSG00000068479
• Gene ID - Rat: ENSRNOG00000014436
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.