Anti MEX3D pAb (ATL-HPA065385)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065385-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MEX3D
Alternative Gene Name: KIAA2031, OK/SW-cl.4, RKHD1, RNF193, Tino
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048696: 77%, ENSRNOG00000030830: 77%
Entrez Gene ID: 399664
Uniprot ID: Q86XN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DVFAGFAPHPAALGPPTLLADQMSVICGRKK |
| Gene Sequence | DVFAGFAPHPAALGPPTLLADQMSVICGRKK |
| Gene ID - Mouse | ENSMUSG00000048696 |
| Gene ID - Rat | ENSRNOG00000030830 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MEX3D pAb (ATL-HPA065385) | |
| Datasheet | Anti MEX3D pAb (ATL-HPA065385) Datasheet (External Link) |
| Vendor Page | Anti MEX3D pAb (ATL-HPA065385) at Atlas Antibodies |
| Documents & Links for Anti MEX3D pAb (ATL-HPA065385) | |
| Datasheet | Anti MEX3D pAb (ATL-HPA065385) Datasheet (External Link) |
| Vendor Page | Anti MEX3D pAb (ATL-HPA065385) |