Anti MEX3D pAb (ATL-HPA065385)

Atlas Antibodies

Catalog No.:
ATL-HPA065385-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mex-3 RNA binding family member D
Gene Name: MEX3D
Alternative Gene Name: KIAA2031, OK/SW-cl.4, RKHD1, RNF193, Tino
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048696: 77%, ENSRNOG00000030830: 77%
Entrez Gene ID: 399664
Uniprot ID: Q86XN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVFAGFAPHPAALGPPTLLADQMSVICGRKK
Gene Sequence DVFAGFAPHPAALGPPTLLADQMSVICGRKK
Gene ID - Mouse ENSMUSG00000048696
Gene ID - Rat ENSRNOG00000030830
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MEX3D pAb (ATL-HPA065385)
Datasheet Anti MEX3D pAb (ATL-HPA065385) Datasheet (External Link)
Vendor Page Anti MEX3D pAb (ATL-HPA065385) at Atlas Antibodies

Documents & Links for Anti MEX3D pAb (ATL-HPA065385)
Datasheet Anti MEX3D pAb (ATL-HPA065385) Datasheet (External Link)
Vendor Page Anti MEX3D pAb (ATL-HPA065385)