Anti MEX3D pAb (ATL-HPA065385)

Atlas Antibodies

SKU: ATL-HPA065385-25

• 

Protein Description: mex-3 RNA binding family member D
Gene Name: MEX3D
Alternative Gene Name: KIAA2031, OK/SW-cl.4, RKHD1, RNF193, Tino
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048696: 77%, ENSRNOG00000030830: 77%
Entrez Gene ID: 399664
Uniprot ID: Q86XN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVFAGFAPHPAALGPPTLLADQMSVICGRKK
• Gene Sequence: DVFAGFAPHPAALGPPTLLADQMSVICGRKK
• Gene ID - Mouse: ENSMUSG00000048696
• Gene ID - Rat: ENSRNOG00000030830
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.