Anti MEX3C pAb (ATL-HPA040603)

Atlas Antibodies

Catalog No.:
ATL-HPA040603-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mex-3 RNA binding family member C
Gene Name: MEX3C
Alternative Gene Name: FLJ38871, RKHD2, RNF194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037253: 99%, ENSRNOG00000015777: 100%
Entrez Gene ID: 51320
Uniprot ID: Q5U5Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSP
Gene Sequence NRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSP
Gene ID - Mouse ENSMUSG00000037253
Gene ID - Rat ENSRNOG00000015777
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MEX3C pAb (ATL-HPA040603)
Datasheet Anti MEX3C pAb (ATL-HPA040603) Datasheet (External Link)
Vendor Page Anti MEX3C pAb (ATL-HPA040603) at Atlas Antibodies

Documents & Links for Anti MEX3C pAb (ATL-HPA040603)
Datasheet Anti MEX3C pAb (ATL-HPA040603) Datasheet (External Link)
Vendor Page Anti MEX3C pAb (ATL-HPA040603)