Anti METTL9 pAb (ATL-HPA053588)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053588-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: METTL9
Alternative Gene Name: DREV1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030876: 99%, ENSRNOG00000025940: 100%
Entrez Gene ID: 51108
Uniprot ID: Q9H1A3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVL |
| Gene Sequence | VILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVL |
| Gene ID - Mouse | ENSMUSG00000030876 |
| Gene ID - Rat | ENSRNOG00000025940 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti METTL9 pAb (ATL-HPA053588) | |
| Datasheet | Anti METTL9 pAb (ATL-HPA053588) Datasheet (External Link) |
| Vendor Page | Anti METTL9 pAb (ATL-HPA053588) at Atlas Antibodies |
| Documents & Links for Anti METTL9 pAb (ATL-HPA053588) | |
| Datasheet | Anti METTL9 pAb (ATL-HPA053588) Datasheet (External Link) |
| Vendor Page | Anti METTL9 pAb (ATL-HPA053588) |