Anti METTL22 pAb (ATL-HPA074173)

Atlas Antibodies

SKU:
ATL-HPA074173-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 22
Gene Name: METTL22
Alternative Gene Name: C16orf68, FLJ12433, MGC2654
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039345: 82%, ENSRNOG00000002714: 82%
Entrez Gene ID: 79091
Uniprot ID: Q9BUU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NACTAILSVEKRLNFTLRHLDVTCEAYDHFRSCLHALEQLTDGKLRFVVEPVEASFPQLLVYERLQQLELWKIIAEP
Gene Sequence NACTAILSVEKRLNFTLRHLDVTCEAYDHFRSCLHALEQLTDGKLRFVVEPVEASFPQLLVYERLQQLELWKIIAEP
Gene ID - Mouse ENSMUSG00000039345
Gene ID - Rat ENSRNOG00000002714
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti METTL22 pAb (ATL-HPA074173)
Datasheet Anti METTL22 pAb (ATL-HPA074173) Datasheet (External Link)
Vendor Page Anti METTL22 pAb (ATL-HPA074173) at Atlas Antibodies

Documents & Links for Anti METTL22 pAb (ATL-HPA074173)
Datasheet Anti METTL22 pAb (ATL-HPA074173) Datasheet (External Link)
Vendor Page Anti METTL22 pAb (ATL-HPA074173)