Anti METTL22 pAb (ATL-HPA059882)

Atlas Antibodies

Catalog No.:
ATL-HPA059882-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 22
Gene Name: METTL22
Alternative Gene Name: C16orf68, FLJ12433, MGC2654
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039345: 80%, ENSRNOG00000002714: 80%
Entrez Gene ID: 79091
Uniprot ID: Q9BUU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEDGDLDVVRRPRAASDSNPAGPLRDKVHPMILAQEEDDVLGEEAQGSPHDIIRIEHTMATPLEDVGKQV
Gene Sequence DEDGDLDVVRRPRAASDSNPAGPLRDKVHPMILAQEEDDVLGEEAQGSPHDIIRIEHTMATPLEDVGKQV
Gene ID - Mouse ENSMUSG00000039345
Gene ID - Rat ENSRNOG00000002714
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti METTL22 pAb (ATL-HPA059882)
Datasheet Anti METTL22 pAb (ATL-HPA059882) Datasheet (External Link)
Vendor Page Anti METTL22 pAb (ATL-HPA059882) at Atlas Antibodies

Documents & Links for Anti METTL22 pAb (ATL-HPA059882)
Datasheet Anti METTL22 pAb (ATL-HPA059882) Datasheet (External Link)
Vendor Page Anti METTL22 pAb (ATL-HPA059882)