Anti METTL17 pAb (ATL-HPA059802)

Atlas Antibodies

Catalog No.:
ATL-HPA059802-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: methyltransferase like 17
Gene Name: METTL17
Alternative Gene Name: FLJ20859, METT11D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004561: 89%, ENSRNOG00000025512: 88%
Entrez Gene ID: 64745
Uniprot ID: Q9H7H0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSWNKKPKEEKFSMVILARGSPEEAHRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRHGRDLYRCARVSSWGDLLPVL
Gene Sequence DPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSWNKKPKEEKFSMVILARGSPEEAHRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRHGRDLYRCARVSSWGDLLPVL
Gene ID - Mouse ENSMUSG00000004561
Gene ID - Rat ENSRNOG00000025512
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti METTL17 pAb (ATL-HPA059802)
Datasheet Anti METTL17 pAb (ATL-HPA059802) Datasheet (External Link)
Vendor Page Anti METTL17 pAb (ATL-HPA059802) at Atlas Antibodies

Documents & Links for Anti METTL17 pAb (ATL-HPA059802)
Datasheet Anti METTL17 pAb (ATL-HPA059802) Datasheet (External Link)
Vendor Page Anti METTL17 pAb (ATL-HPA059802)