Anti METTL16 pAb (ATL-HPA020352 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA020352-25

Protein Description: methyltransferase like 16
Gene Name: METTL16
Alternative Gene Name: METT10D, MGC3329
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010554: 66%, ENSRNOG00000002764: 66%
Entrez Gene ID: 79066
Uniprot ID: Q86W50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DERSEEKGGVEVLESCQGSSNGAQDQEASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMHWVE
• Gene Sequence: DERSEEKGGVEVLESCQGSSNGAQDQEASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMHWVE
• Gene ID - Mouse: ENSMUSG00000010554
• Gene ID - Rat: ENSRNOG00000002764
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti METTL16 pAb (ATL-HPA020352 w/enhanced validation) – 5 Found

Brown, Jessica A; Kinzig, Charles G; DeGregorio, Suzanne J; Steitz, Joan A. Methyltransferase-like protein 16 binds the 3'-terminal triple helix of MALAT1 long noncoding RNA. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(49):14013-14018. 

Wang, Xiao-Kun; Zhang, Ya-Wei; Wang, Chun-Ming; Li, Bo; Zhang, Tian-Zhi; Zhou, Wen-Jie; Cheng, Lyu-Jia; Huo, Ming-Yu; Zhang, Chang-Hua; He, Yu-Long. METTL16 promotes cell proliferation by up-regulating cyclin D1 expression in gastric cancer. Journal Of Cellular And Molecular Medicine. 2021;25(14):6602-6617. 

Stixová, Lenka; Komůrková, Denisa; Svobodová Kovaříková, Alena; Fagherazzi, Paolo; Bártová, Eva. Localization of METTL16 at the Nuclear Periphery and the Nucleolus Is Cell Cycle-Specific and METTL16 Interacts with Several Nucleolar Proteins. Life (Basel, Switzerland). 2021;11(7) 

Svobodová Kovaříková, Alena; Stixová, Lenka; Kovařík, Aleš; Komůrková, Denisa; Legartová, Soňa; Fagherazzi, Paolo; Bártová, Eva. N(6)-Adenosine Methylation in RNA and a Reduced m(3)G/TMG Level in Non-Coding RNAs Appear at Microirradiation-Induced DNA Lesions. Cells. 2020;9(2) 

Su, Rui; Dong, Lei; Li, Yangchan; Gao, Min; He, P Cody; Liu, Wei; Wei, Jiangbo; Zhao, Zhicong; Gao, Lei; Han, Li; Deng, Xiaolan; Li, Chenying; Prince, Emily; Tan, Brandon; Qing, Ying; Qin, Xi; Shen, Chao; Xue, Meilin; Zhou, Keren; Chen, Zhenhua; Xue, Jianhuang; Li, Wei; Qin, Hanjun; Wu, Xiwei; Sun, Miao; Nam, Yunsun; Chen, Chun-Wei; Huang, Wendong; Horne, David; Rosen, Steven T; He, Chuan; Chen, Jianjun. METTL16 exerts an m(6)A-independent function to facilitate translation and tumorigenesis. Nature Cell Biology. 2022;24(2):205-216.