Anti METTL1 pAb (ATL-HPA050450)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050450-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: METTL1
Alternative Gene Name: C12orf1, TRM8, TRMT8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006732: 90%, ENSRNOG00000047895: 89%
Entrez Gene ID: 4234
Uniprot ID: Q9UBP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQ |
Gene Sequence | NQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQ |
Gene ID - Mouse | ENSMUSG00000006732 |
Gene ID - Rat | ENSRNOG00000047895 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti METTL1 pAb (ATL-HPA050450) | |
Datasheet | Anti METTL1 pAb (ATL-HPA050450) Datasheet (External Link) |
Vendor Page | Anti METTL1 pAb (ATL-HPA050450) at Atlas Antibodies |
Documents & Links for Anti METTL1 pAb (ATL-HPA050450) | |
Datasheet | Anti METTL1 pAb (ATL-HPA050450) Datasheet (External Link) |
Vendor Page | Anti METTL1 pAb (ATL-HPA050450) |