Anti METTL1 pAb (ATL-HPA020914)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020914-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: METTL1
Alternative Gene Name: C12orf1, TRM8, TRMT8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006732: 83%, ENSRNOG00000047895: 84%
Entrez Gene ID: 4234
Uniprot ID: Q9UBP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH |
| Gene Sequence | MCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH |
| Gene ID - Mouse | ENSMUSG00000006732 |
| Gene ID - Rat | ENSRNOG00000047895 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti METTL1 pAb (ATL-HPA020914) | |
| Datasheet | Anti METTL1 pAb (ATL-HPA020914) Datasheet (External Link) |
| Vendor Page | Anti METTL1 pAb (ATL-HPA020914) at Atlas Antibodies |
| Documents & Links for Anti METTL1 pAb (ATL-HPA020914) | |
| Datasheet | Anti METTL1 pAb (ATL-HPA020914) Datasheet (External Link) |
| Vendor Page | Anti METTL1 pAb (ATL-HPA020914) |