Anti METRN pAb (ATL-HPA051164)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051164-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: METRN
Alternative Gene Name: C16orf23, MGC2601
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002274: 77%, ENSRNOG00000019692: 75%
Entrez Gene ID: 79006
Uniprot ID: Q9UJH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VTHDVELQESVITVVAARVLRQTPPLFQAGRSGDQGLTSIRTPLRCGVHPGPGTFLFMGWSRFG |
| Gene Sequence | VTHDVELQESVITVVAARVLRQTPPLFQAGRSGDQGLTSIRTPLRCGVHPGPGTFLFMGWSRFG |
| Gene ID - Mouse | ENSMUSG00000002274 |
| Gene ID - Rat | ENSRNOG00000019692 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti METRN pAb (ATL-HPA051164) | |
| Datasheet | Anti METRN pAb (ATL-HPA051164) Datasheet (External Link) |
| Vendor Page | Anti METRN pAb (ATL-HPA051164) at Atlas Antibodies |
| Documents & Links for Anti METRN pAb (ATL-HPA051164) | |
| Datasheet | Anti METRN pAb (ATL-HPA051164) Datasheet (External Link) |
| Vendor Page | Anti METRN pAb (ATL-HPA051164) |