Anti METRN pAb (ATL-HPA051164)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051164-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: METRN
Alternative Gene Name: C16orf23, MGC2601
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002274: 77%, ENSRNOG00000019692: 75%
Entrez Gene ID: 79006
Uniprot ID: Q9UJH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VTHDVELQESVITVVAARVLRQTPPLFQAGRSGDQGLTSIRTPLRCGVHPGPGTFLFMGWSRFG |
Gene Sequence | VTHDVELQESVITVVAARVLRQTPPLFQAGRSGDQGLTSIRTPLRCGVHPGPGTFLFMGWSRFG |
Gene ID - Mouse | ENSMUSG00000002274 |
Gene ID - Rat | ENSRNOG00000019692 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti METRN pAb (ATL-HPA051164) | |
Datasheet | Anti METRN pAb (ATL-HPA051164) Datasheet (External Link) |
Vendor Page | Anti METRN pAb (ATL-HPA051164) at Atlas Antibodies |
Documents & Links for Anti METRN pAb (ATL-HPA051164) | |
Datasheet | Anti METRN pAb (ATL-HPA051164) Datasheet (External Link) |
Vendor Page | Anti METRN pAb (ATL-HPA051164) |