Anti METRN pAb (ATL-HPA051164)

Atlas Antibodies

Catalog No.:
ATL-HPA051164-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: meteorin, glial cell differentiation regulator
Gene Name: METRN
Alternative Gene Name: C16orf23, MGC2601
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002274: 77%, ENSRNOG00000019692: 75%
Entrez Gene ID: 79006
Uniprot ID: Q9UJH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTHDVELQESVITVVAARVLRQTPPLFQAGRSGDQGLTSIRTPLRCGVHPGPGTFLFMGWSRFG
Gene Sequence VTHDVELQESVITVVAARVLRQTPPLFQAGRSGDQGLTSIRTPLRCGVHPGPGTFLFMGWSRFG
Gene ID - Mouse ENSMUSG00000002274
Gene ID - Rat ENSRNOG00000019692
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti METRN pAb (ATL-HPA051164)
Datasheet Anti METRN pAb (ATL-HPA051164) Datasheet (External Link)
Vendor Page Anti METRN pAb (ATL-HPA051164) at Atlas Antibodies

Documents & Links for Anti METRN pAb (ATL-HPA051164)
Datasheet Anti METRN pAb (ATL-HPA051164) Datasheet (External Link)
Vendor Page Anti METRN pAb (ATL-HPA051164)