Anti METRN pAb (ATL-HPA051164)

Atlas Antibodies

Catalog No.: ATL-HPA051164-25

Protein Description: meteorin, glial cell differentiation regulator
Gene Name: METRN
Alternative Gene Name: C16orf23, MGC2601
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002274: 77%, ENSRNOG00000019692: 75%
Entrez Gene ID: 79006
Uniprot ID: Q9UJH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTHDVELQESVITVVAARVLRQTPPLFQAGRSGDQGLTSIRTPLRCGVHPGPGTFLFMGWSRFG
• Gene Sequence: VTHDVELQESVITVVAARVLRQTPPLFQAGRSGDQGLTSIRTPLRCGVHPGPGTFLFMGWSRFG
• Gene ID - Mouse: ENSMUSG00000002274
• Gene ID - Rat: ENSRNOG00000019692
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.