Anti METAP1D pAb (ATL-HPA030299 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030299-25

Protein Description: methionyl aminopeptidase type 1D (mitochondrial)
Gene Name: METAP1D
Alternative Gene Name: MAP1D, Metap1l
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041921: 90%, ENSRNOG00000061587: 90%
Entrez Gene ID: 254042
Uniprot ID: Q6UB28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGG
• Gene Sequence: KPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGG
• Gene ID - Mouse: ENSMUSG00000041921
• Gene ID - Rat: ENSRNOG00000061587
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.