Anti MET pAb (ATL-HPA055607)

Atlas Antibodies

Catalog No.: ATL-HPA055607-25

Protein Description: MET proto-oncogene, receptor tyrosine kinase
Gene Name: MET
Alternative Gene Name: DFNB97, HGFR, RCCP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009376: 97%, ENSRNOG00000052745: 97%
Entrez Gene ID: 4233
Uniprot ID: P08581
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN
• Gene Sequence: SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN
• Gene ID - Mouse: ENSMUSG00000009376
• Gene ID - Rat: ENSRNOG00000052745
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.