Anti MET pAb (ATL-HPA055607)

Atlas Antibodies

Catalog No.:
ATL-HPA055607-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: MET proto-oncogene, receptor tyrosine kinase
Gene Name: MET
Alternative Gene Name: DFNB97, HGFR, RCCP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009376: 97%, ENSRNOG00000052745: 97%
Entrez Gene ID: 4233
Uniprot ID: P08581
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN
Gene Sequence SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN
Gene ID - Mouse ENSMUSG00000009376
Gene ID - Rat ENSRNOG00000052745
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MET pAb (ATL-HPA055607)
Datasheet Anti MET pAb (ATL-HPA055607) Datasheet (External Link)
Vendor Page Anti MET pAb (ATL-HPA055607) at Atlas Antibodies

Documents & Links for Anti MET pAb (ATL-HPA055607)
Datasheet Anti MET pAb (ATL-HPA055607) Datasheet (External Link)
Vendor Page Anti MET pAb (ATL-HPA055607)