Anti MET pAb (ATL-HPA055607)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055607-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: MET
Alternative Gene Name: DFNB97, HGFR, RCCP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009376: 97%, ENSRNOG00000052745: 97%
Entrez Gene ID: 4233
Uniprot ID: P08581
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN |
| Gene Sequence | SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN |
| Gene ID - Mouse | ENSMUSG00000009376 |
| Gene ID - Rat | ENSRNOG00000052745 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MET pAb (ATL-HPA055607) | |
| Datasheet | Anti MET pAb (ATL-HPA055607) Datasheet (External Link) |
| Vendor Page | Anti MET pAb (ATL-HPA055607) at Atlas Antibodies |
| Documents & Links for Anti MET pAb (ATL-HPA055607) | |
| Datasheet | Anti MET pAb (ATL-HPA055607) Datasheet (External Link) |
| Vendor Page | Anti MET pAb (ATL-HPA055607) |