Anti MESDC1 pAb (ATL-HPA071716)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071716-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MESDC1
Alternative Gene Name: MGC99595
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070462: 98%, ENSRNOG00000012349: 98%
Entrez Gene ID: 59274
Uniprot ID: Q9H1K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLTQCLRDLAQHPDGGAKMSDHRERLRNSACAVSEGCTLLSQALRERSSPRTLPPVNSNSVN |
Gene Sequence | LLTQCLRDLAQHPDGGAKMSDHRERLRNSACAVSEGCTLLSQALRERSSPRTLPPVNSNSVN |
Gene ID - Mouse | ENSMUSG00000070462 |
Gene ID - Rat | ENSRNOG00000012349 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MESDC1 pAb (ATL-HPA071716) | |
Datasheet | Anti MESDC1 pAb (ATL-HPA071716) Datasheet (External Link) |
Vendor Page | Anti MESDC1 pAb (ATL-HPA071716) at Atlas Antibodies |
Documents & Links for Anti MESDC1 pAb (ATL-HPA071716) | |
Datasheet | Anti MESDC1 pAb (ATL-HPA071716) Datasheet (External Link) |
Vendor Page | Anti MESDC1 pAb (ATL-HPA071716) |