Anti MERTK pAb (ATL-HPA075622)

Atlas Antibodies

Catalog No.: ATL-HPA075622-25

Protein Description: MER proto-oncogene, tyrosine kinase
Gene Name: MERTK
Alternative Gene Name: c-Eyk, mer, RP38, Tyro12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014361: 82%, ENSRNOG00000017319: 83%
Entrez Gene ID: 10461
Uniprot ID: Q12866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA
• Gene Sequence: PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA
• Gene ID - Mouse: ENSMUSG00000014361
• Gene ID - Rat: ENSRNOG00000017319
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.