Anti MERTK pAb (ATL-HPA075622)

Atlas Antibodies

Catalog No.:
ATL-HPA075622-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: MER proto-oncogene, tyrosine kinase
Gene Name: MERTK
Alternative Gene Name: c-Eyk, mer, RP38, Tyro12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014361: 82%, ENSRNOG00000017319: 83%
Entrez Gene ID: 10461
Uniprot ID: Q12866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA
Gene Sequence PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA
Gene ID - Mouse ENSMUSG00000014361
Gene ID - Rat ENSRNOG00000017319
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MERTK pAb (ATL-HPA075622)
Datasheet Anti MERTK pAb (ATL-HPA075622) Datasheet (External Link)
Vendor Page Anti MERTK pAb (ATL-HPA075622) at Atlas Antibodies

Documents & Links for Anti MERTK pAb (ATL-HPA075622)
Datasheet Anti MERTK pAb (ATL-HPA075622) Datasheet (External Link)
Vendor Page Anti MERTK pAb (ATL-HPA075622)