Anti MERTK pAb (ATL-HPA075622)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075622-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MERTK
Alternative Gene Name: c-Eyk, mer, RP38, Tyro12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014361: 82%, ENSRNOG00000017319: 83%
Entrez Gene ID: 10461
Uniprot ID: Q12866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA |
| Gene Sequence | PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA |
| Gene ID - Mouse | ENSMUSG00000014361 |
| Gene ID - Rat | ENSRNOG00000017319 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MERTK pAb (ATL-HPA075622) | |
| Datasheet | Anti MERTK pAb (ATL-HPA075622) Datasheet (External Link) |
| Vendor Page | Anti MERTK pAb (ATL-HPA075622) at Atlas Antibodies |
| Documents & Links for Anti MERTK pAb (ATL-HPA075622) | |
| Datasheet | Anti MERTK pAb (ATL-HPA075622) Datasheet (External Link) |
| Vendor Page | Anti MERTK pAb (ATL-HPA075622) |