Anti MEP1A pAb (ATL-HPA029416 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029416-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MEP1A
Alternative Gene Name: PPHA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023914: 65%, ENSRNOG00000011022: 63%
Entrez Gene ID: 4224
Uniprot ID: Q16819
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSSSMVFTTSKSHTSPAINDTVIWDRPSRVGTYHTDCNCFRSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLSQTEVPTKGKRLSPQGLILQGQEQQVSEEGSGKAMLEEALPVSLSQGQPSRQKRSVE |
| Gene Sequence | MSSSMVFTTSKSHTSPAINDTVIWDRPSRVGTYHTDCNCFRSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLSQTEVPTKGKRLSPQGLILQGQEQQVSEEGSGKAMLEEALPVSLSQGQPSRQKRSVE |
| Gene ID - Mouse | ENSMUSG00000023914 |
| Gene ID - Rat | ENSRNOG00000011022 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MEP1A pAb (ATL-HPA029416 w/enhanced validation) | |
| Datasheet | Anti MEP1A pAb (ATL-HPA029416 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MEP1A pAb (ATL-HPA029416 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MEP1A pAb (ATL-HPA029416 w/enhanced validation) | |
| Datasheet | Anti MEP1A pAb (ATL-HPA029416 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MEP1A pAb (ATL-HPA029416 w/enhanced validation) |