Anti MEOX2 pAb (ATL-HPA053793 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053793-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MEOX2
Alternative Gene Name: GAX, MOX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036144: 95%, ENSRNOG00000006588: 96%
Entrez Gene ID: 4223
Uniprot ID: P50222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKR |
Gene Sequence | QQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKR |
Gene ID - Mouse | ENSMUSG00000036144 |
Gene ID - Rat | ENSRNOG00000006588 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MEOX2 pAb (ATL-HPA053793 w/enhanced validation) | |
Datasheet | Anti MEOX2 pAb (ATL-HPA053793 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MEOX2 pAb (ATL-HPA053793 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MEOX2 pAb (ATL-HPA053793 w/enhanced validation) | |
Datasheet | Anti MEOX2 pAb (ATL-HPA053793 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MEOX2 pAb (ATL-HPA053793 w/enhanced validation) |
Citations for Anti MEOX2 pAb (ATL-HPA053793 w/enhanced validation) – 2 Found |
Proserpio, Carla; Galardi, Silvia; Desimio, Maria Giovanna; Michienzi, Alessandro; Doria, Margherita; Minutolo, Antonella; Matteucci, Claudia; Ciafrè, Silvia Anna. MEOX2 Regulates the Growth and Survival of Glioblastoma Stem Cells by Modulating Genes of the Glycolytic Pathway and Response to Hypoxia. Cancers. 2022;14(9) PubMed |
Sawada, Junko; Hiraoka, Nobuyoshi; Qi, Rongsu; Jiang, Lu; Fournier-Goss, Ashley E; Yoshida, Masayuki; Kawashima, Hiroto; Komatsu, Masanobu. Molecular Signature of Tumor-Associated High Endothelial Venules That Can Predict Breast Cancer Survival. Cancer Immunology Research. 2022;10(4):468-481. PubMed |