Anti MEIS2 pAb (ATL-HPA003256)

Atlas Antibodies

Catalog No.: ATL-HPA003256-25

Protein Description: Meis homeobox 2
Gene Name: MEIS2
Alternative Gene Name: HsT18361, MRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027210: 100%, ENSRNOG00000004730: 100%
Entrez Gene ID: 4212
Uniprot ID: O14770
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSV
• Gene Sequence: LEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSV
• Gene ID - Mouse: ENSMUSG00000027210
• Gene ID - Rat: ENSRNOG00000004730
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MEIS2 pAb (ATL-HPA003256) – 2 Found

He, Bing; Ebarasi, Lwaki; Zhao, Zhe; Guo, Jing; Ojala, Juha R M; Hultenby, Kjell; De Val, Sarah; Betsholtz, Christer; Tryggvason, Karl. Lmx1b and FoxC combinatorially regulate podocin expression in podocytes. Journal Of The American Society Of Nephrology : Jasn. 2014;25(12):2764-77. 

De Wyn, Jolien; Zimmerman, Mark W; Weichert-Leahey, Nina; Nunes, Carolina; Cheung, Belamy B; Abraham, Brian J; Beckers, Anneleen; Volders, Pieter-Jan; Decaesteker, Bieke; Carter, Daniel R; Look, Alfred Thomas; De Preter, Katleen; Van Loocke, Wouter; Marshall, Glenn M; Durbin, Adam D; Speleman, Frank; Durinck, Kaat. MEIS2 Is an Adrenergic Core Regulatory Transcription Factor Involved in Early Initiation of TH-MYCN-Driven Neuroblastoma Formation. Cancers. 2021;13(19)