Anti MEIOB pAb (ATL-HPA042547)

Atlas Antibodies

Catalog No.:
ATL-HPA042547-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: meiosis specific with OB domains
Gene Name: MEIOB
Alternative Gene Name: C16orf73, MGC35212
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024155: 86%, ENSRNOG00000014711: 88%
Entrez Gene ID: 254528
Uniprot ID: Q8N635
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NMANLKVIGIVIGKTDVKGFPDRKNIGSERYTFSFTIRDSPAHFVNAASWGNEDYIKSLSDSFRVGDCVIIENPLIQRKEI
Gene Sequence NMANLKVIGIVIGKTDVKGFPDRKNIGSERYTFSFTIRDSPAHFVNAASWGNEDYIKSLSDSFRVGDCVIIENPLIQRKEI
Gene ID - Mouse ENSMUSG00000024155
Gene ID - Rat ENSRNOG00000014711
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MEIOB pAb (ATL-HPA042547)
Datasheet Anti MEIOB pAb (ATL-HPA042547) Datasheet (External Link)
Vendor Page Anti MEIOB pAb (ATL-HPA042547) at Atlas Antibodies

Documents & Links for Anti MEIOB pAb (ATL-HPA042547)
Datasheet Anti MEIOB pAb (ATL-HPA042547) Datasheet (External Link)
Vendor Page Anti MEIOB pAb (ATL-HPA042547)