Anti MEGF9 pAb (ATL-HPA050238)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050238-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MEGF9
Alternative Gene Name: EGFL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039270: 86%, ENSRNOG00000005932: 84%
Entrez Gene ID: 1955
Uniprot ID: Q9H1U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SELEPECDQCKDGYIGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESGECINCLHNTTGFWCENCLEGYVHDLEGNCIKKEVILPTPEGSTILVSNASLTTSVPTPVINSTFTPTTLQTIFSVST |
| Gene Sequence | SELEPECDQCKDGYIGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESGECINCLHNTTGFWCENCLEGYVHDLEGNCIKKEVILPTPEGSTILVSNASLTTSVPTPVINSTFTPTTLQTIFSVST |
| Gene ID - Mouse | ENSMUSG00000039270 |
| Gene ID - Rat | ENSRNOG00000005932 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MEGF9 pAb (ATL-HPA050238) | |
| Datasheet | Anti MEGF9 pAb (ATL-HPA050238) Datasheet (External Link) |
| Vendor Page | Anti MEGF9 pAb (ATL-HPA050238) at Atlas Antibodies |
| Documents & Links for Anti MEGF9 pAb (ATL-HPA050238) | |
| Datasheet | Anti MEGF9 pAb (ATL-HPA050238) Datasheet (External Link) |
| Vendor Page | Anti MEGF9 pAb (ATL-HPA050238) |